PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_14143A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 221aa    MW: 25238.7 Da    PI: 10.0705
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_14143AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.81.8e-161562148
                               TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                               +g W++eEd++l d++ ++G g+W++++++ g+ R +k+c++rw +yl
  Oropetium_20150105_14143A 15 KGLWSPEEDQRLRDYILKHGLGCWSAVPAKAGLQRNGKSCRLRWINYL 62
                               678*******************************************97 PP

2Myb_DNA-binding53.65.3e-1768113148
                                TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
            Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                rg +++eE+++ +++ ++lG++ W+ Ia +++ gRt++++k++w++yl
  Oropetium_20150105_14143A  68 RGMFSQEEEDIVINLQAKLGNK-WSQIAMHLP-GRTDNEVKNYWNSYL 113
                                788*******************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.461062IPR017930Myb domain
SuperFamilySSF466892.49E-2912109IPR009057Homeodomain-like
SMARTSM007171.6E-111464IPR001005SANT/Myb domain
PfamPF002491.4E-141562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-221669IPR009057Homeodomain-like
CDDcd001672.82E-101862No hitNo description
PROSITE profilePS5129425.6963117IPR017930Myb domain
SMARTSM007172.2E-1567115IPR001005SANT/Myb domain
PfamPF002492.8E-1568113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-2570117IPR009057Homeodomain-like
CDDcd001672.50E-1271113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MGCRSCEKPK MNYRKGLWSP EEDQRLRDYI LKHGLGCWSA VPAKAGLQRN GKSCRLRWIN  60
YLRPGLKRGM FSQEEEDIVI NLQAKLGNKW SQIAMHLPGR TDNEVKNYWN SYLKKRVMQA  120
QGSNPKSPPE LTXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXSAPAPV VLQPFDHQVT  180
QQQQQPKNFV FSDWAPAPES YSVSAHWPAS TASSGNVTPS H
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-26911723128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3686641e-122AK368664.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2077L03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004952152.11e-120PREDICTED: transcription factor LAF1-like
SwissprotQ9M0K43e-54LAF1_ARATH; Transcription factor LAF1
SwissprotQ8LPH69e-54MYB86_ARATH; Transcription factor MYB86
TrEMBLK3YUF31e-120K3YUF3_SETIT; Uncharacterized protein
STRINGSi017899m1e-119(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP122962735
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52260.11e-55myb domain protein 19